GenomeNet

>baml:BAM5036_2744 K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] | (GenBank) tgl; protein-glutamine gamma-glutamyltransferase (transglutaminase) (A)
MIIISGQVLRPHDIANWQTEESLVPYINELLNSPVQFDYGSIAELMFEVRLRRHIVEAAR
KLHGSGVKFATFAKTYGNTAYWRVTPEGALELKYRIPASKAIRDIIENGAFYAFECATAI
VVIYYLAVLKTIGEERFNRRFRDITLYDWHYEHLPIYTETGSHFLRGDCLYFKNPDFNPA
KAQWRGENVIVMGNDQYFAHGLGILTAEQIIQRLNSLRKKNAVQPAYLLNQATRLDAPAL
YQIMH

BLAST