GenomeNet

>bamn:BASU_2750 K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] | (GenBank) tgl; protein-glutamine gamma-glutamyltransferase (transglutaminase) (EC:2.3.2.13) (A)
MIIISGQVLRPQDIANWQTEKSLVPYINELLNSPVQFDYGSIAELMFEVRLRRHIVEAAR
ELHGSGVKFATFAKTYGNTAYWRVTPEGALELKYRIPASKAIRDIIENGAFYAFECATAI
VVIYYLAVLKTIGEERFNRRFRDITLYDWHYEHLPIYTETGSHFLRGDCLYFKNPDFNPA
KAQWRGENVIVMGNDQYFAHGLGILTAEQIIQRLNSLRKKNAVQPAYLLNQATRLDAPAL
YQIMH

BLAST