GenomeNet

>bamp:B938_17555 thymidine kinase (EC:2.7.1.21); K00857 thymidine kinase [EC:2.7.1.21] (A)
MYIMKQSGWLELICGSMFSGKSEELIRRVKRATYAKQEVKVFKPAIDNRYSEEAVVSHNG
TSMTSHVISSSAEIWDHISESTDVIAVDEVQFFGESIIGDLSSLADKGYRVIAAGLDMDF
RGEPFGVVPNLMAVAESVMKLQAVCSVCGSPASRTQRLIDGKPASYDDPVILVGASESYE
ARCRHHHEVPKKTD

BLAST