GenomeNet

>bay:RBAM_013180 ykoU; YkoU; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MVLTMQPILTSVPPEGSEWRYEVKYDGFRCLLRIDESGVTLTSRNGQTLTNQFPEITAFA
ARCFQHMKDRFPITLDGELVYLINPYRADFEHLQIRGRLKRTEAIESTADRRPCRFLAFD
LLVLEGAGTVSLPYVKRKRALSKLLKEANLPACPHHLAEEAIQYIPEHTDFDALWDKVVR
HDGEGIVAKRASSGWAENKRSPDWQKYKHMKTAHVLLTGFNPKNGYVTASVLKDGTAVPI
ASVSHGMQAEEKNAVRTIMETHGKKQNSGEYTLEPSICMTVQYLTILQDTLREVSFVSFQ
FEMDWTECTYQQLILHSKTLPPKLQFTSLDKIVFKKREKTKADFLSYMVKMSDFLMPFLK
DRAVTVIRYPHGAPGESFFQKNKPDYTPDFVSSVFDGSHEHIVCSSIPSLLWLANQLALE
FHVPFQTVHSERPAEIVIDLDPPSRNDFPMAVEAAHVLKQLFDSFSITSFPKLSGNKGIQ
LYIPLSPEAFTYEETRAFTMLIADYCVRTRPDLFTTERFIKNRNGRLYLDYLQHAEGKTI
IAPYSTRGNELGTVAAPLYWSEVNSSLTPDDYTIDTVVNRVRTEGDPFYDFYRNPQDGPL
SIVLEQIKRKS

BLAST