GenomeNet

>bay:RBAM_022540 yncD; hypothetical protein; K01775 alanine racemase [EC:5.1.1.1] (A)
MKKLCREVWIEVDLDAIKKNVRAIRRHIPNTSKIMAVVKANAYGHGSVEVARQALESGAS
ELAVASVEEGIVLRRAGITAPILVLGFTALSCVKKSAVWNITLSAFQVSWIKKANRILEK
EADSKRLSIHINVDTGMGRLGVRTEEDLLAVVKALKSSTYLSWDGIFTHFSTADEPDTEL
TMLQHEKFISFLRFLKNQDITLPTVHMCNTAAAIAFPEFSADMIRLGIGLYGLYPSASIK
ELNLVDLTPALSLKARIAYVKAMVTDPRTVSYGATYIAEPGEIIATIPIGYGDGYSRALS
NRGFILHRGRRVPVAGRVTMDMIMVSLGENEGKQGEEVVIYGKQQGAEISVDEIAEMLGT
ISYEVLSVLSRRVPRFYFRDGKIIKISAPVLYV

BLAST