GenomeNet

>bay:RBAM_028330 K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] | (GenBank) tgl; Tgl (EC:2.3.2.13) (A)
MKMIIISGQVLRPQDIANWQTEESLVPYINELLNSPVQFDYGSIAELMFEVRLRRHIVEA
ARELHGSGVKFATFAKTYGNTAYWRVTPEGALELKYRIPASKAIRDIIENGAFYAFECAT
AIVVIYYLAVLKTIGEERFNRRFRDITLYDWHYEHLPIYTETGRHFLRGDCLYFKNPDFN
PAKAQWRGENVIVMGNDQYFAHGLGILTAEQIIQRLNSLRKKNAMQPAYLLNQATRLDAP
ALYQIMH

BLAST