GenomeNet

>bba:Bd0295 K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] | (GenBank) sodC; InterPro: Copper/Zinc superoxide dismutase; hypothetical protein (A)
MKRMLLVSLLAVAMTSCMYKSKKAEAPAPAESTPTPTATAAPQKAQAVLKTIKGSKLKGI
IHFTEGDGEMKIETMVEGIKPGPHGFHIHEKGDCSAADFSSAGGHFNPTKGSHAGHDGHG
RHVGDMGNLIADNKSKAITTLVIKGMTMKPGAESIIGKAVVIHADKDDLKSQPAGNSGAR
IACGVIQAL

BLAST