GenomeNet

>bba:Bd0295 sodC; InterPro: Copper/Zinc superoxide dismutase; hypothetical protein (EC:1.15.1.1); K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] (A)
MKRMLLVSLLAVAMTSCMYKSKKAEAPAPAESTPTPTATAAPQKAQAVLKTIKGSKLKGI
IHFTEGDGEMKIETMVEGIKPGPHGFHIHEKGDCSAADFSSAGGHFNPTKGSHAGHDGHG
RHVGDMGNLIADNKSKAITTLVIKGMTMKPGAESIIGKAVVIHADKDDLKSQPAGNSGAR
IACGVIQAL

BLAST