GenomeNet

>bba:Bd0608 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (GenBank) ppc; InterPro: Phosphoenolpyruvate carboxylase,; hypothetical protein (A)
MPGDFLHLHRIITRQKSSQYTTSLDEGKGPKLTLRIGATMQKALAKELTSLVNWAVTELG
HVIEAELGGKQFQRIENIRRFVKSKDGGQLKGLLKLKGDMEVLSPAQRFEIAHSFALMLE
LINACESAYRTHRLLEEKTAPLSEETHAYGRIIHVLTAHPTESRNSDIIFYFRKVHQLLL
QRLTAERHNQTAELHALLRMAWQLPMSKQRKPSVMDEAEYIYSLVLQDDIIEIYLQQRHA
QIPFYIRTWVGGDKDGHPGVNEKTMLGSLSMSRARLHSWVKTQFAAYLADLAPLSRSGLR
QKNDIRKLQRHAVAVKRNLTKTRRISTGDANRVHALNKSVHDLATEQHRLFGAESPTLNR
IRYLLKIFPSLVVPLEIREDSSLVHEALDDSRFRMNISRMLKTLARLSPDHSPRNYVRGF
ILSQCESAKDIEAGIRLSSKILNGPRLPVVPLFESSHSLKNSTEIIRTFLGVKKNKSLIK
KHWSAQLEVMLGYSDSAKENGSFPSRFLIQSAMQGLEATIEKQGLVPIFFHGSGGSIERG
GGSIQEQTEWWPLSALKNVKMTVQGEMIYRSYNSPAILQRQLNLLVQNRDARKQAPATHT
SAINRKALQKLSDSVQQSYQQILQQPDFLELIEKATPYSFMKDLRMGSRPSKRQGPVQLK
SLRAIPWVLCWTQTRALFPTWWGLGSHWKNLTASEKSQYRKAFKESAMFRSYIKAVGFTL
EKIEMDVFFMYLRSSRLNKETITKYENSFRQEFAQTVKCIREITREKSLLWYRPWLETSI
GLRSPLIHPLNVLQLVALETTDIKLLRETVTGIASGMLTTG

BLAST