GenomeNet

>bba:Bd2821 predicted membrane protein (EC:3.2.1.18) (A)
MRFKIISLFATLLLSSFSAQGYVPNSPLTTNDPSFGMTGKFNPAGWSDWITIGGIGTSDP
ASCSLSGFRNIVFVKGTDNALWSRYWNGAEWSEWFSLGGVLTSSPAAACQGEQIYVFARG
TDNALWARYWWGSQWSEWISIGGVLTSGPAVTSWEFGRVDVFVRGTDNALWHKWFASGAW
SEWESLGGILTSDPAAASWSAGRIDVFVRGTDNALWHKWFAGGWSGWESLGGILTSDPDV
ASWGAGRLDVFVRGTDNALWHLWWDSKWSSWESLGGILTSGPGAAALAQGYLIIYVKGTD
QALWFKTFAP

BLAST