GenomeNet

>bba:Bd2821 no KO assigned | (GenBank) predicted membrane protein (A)
MRFKIISLFATLLLSSFSAQGYVPNSPLTTNDPSFGMTGKFNPAGWSDWITIGGIGTSDP
ASCSLSGFRNIVFVKGTDNALWSRYWNGAEWSEWFSLGGVLTSSPAAACQGEQIYVFARG
TDNALWARYWWGSQWSEWISIGGVLTSGPAVTSWEFGRVDVFVRGTDNALWHKWFASGAW
SEWESLGGILTSDPAAASWSAGRIDVFVRGTDNALWHKWFAGGWSGWESLGGILTSDPDV
ASWGAGRLDVFVRGTDNALWHLWWDSKWSSWESLGGILTSGPGAAALAQGYLIIYVKGTD
QALWFKTFAP

BLAST