GenomeNet

>bba:Bd3124 alr; hypothetical protein; K01775 alanine racemase [EC:5.1.1.1] (A)
MEMYRRTFAEINLDHLKHNIQVLQKAFPQAPFLCPMVKANAYGHGDVQLARFLESLGIKH
LGVCLIEEGLLLRRSGVNAEILVFRGFDREGAEKIIEYNMTPVVSSWEQIDHLEAVASDP
VGIHLKFDTGMNRLGFRPEEAQKLFDRLWQNKKIRLKALVTHLFNGEDATDSQGISARQL
RDLNRVSTVFKPFNIFCHALNSAGIMSALQMKDAGNTPADHPLFMQNWGLRPGLMIYGYN
PLGQNSFGGLKPVMSLKSHVATYRQLHIGETVSYGGTWTAKQDSVIAVVPIGYADGYHRI
LSNQSSVVFAGKRVPLVGSICMDYLMLDVTEVVRGKDLKDFKDQEVTLFGFASDGSFLSP
EELAVQAKSITWEMLTSVGERVPRIYSGLDVGFVFEESRGQR

BLAST