GenomeNet

>bba:Bd3124 K01775 alanine racemase [EC:5.1.1.1] | (GenBank) alr; InterPro: Alanine racemase; hypothetical protein (A)
MEMYRRTFAEINLDHLKHNIQVLQKAFPQAPFLCPMVKANAYGHGDVQLARFLESLGIKH
LGVCLIEEGLLLRRSGVNAEILVFRGFDREGAEKIIEYNMTPVVSSWEQIDHLEAVASDP
VGIHLKFDTGMNRLGFRPEEAQKLFDRLWQNKKIRLKALVTHLFNGEDATDSQGISARQL
RDLNRVSTVFKPFNIFCHALNSAGIMSALQMKDAGNTPADHPLFMQNWGLRPGLMIYGYN
PLGQNSFGGLKPVMSLKSHVATYRQLHIGETVSYGGTWTAKQDSVIAVVPIGYADGYHRI
LSNQSSVVFAGKRVPLVGSICMDYLMLDVTEVVRGKDLKDFKDQEVTLFGFASDGSFLSP
EELAVQAKSITWEMLTSVGERVPRIYSGLDVGFVFEESRGQR

BLAST