GenomeNet

>bba:Bd3617 sodB; hypothetical protein; K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] (A)
MFKLPNLPYAKTGIAPLFNEEQMTYHYDKHHKAYIDNLNKFMETDASLKGKSLEEITLTS
TGGIFNNAAQAWNHTFFWFGMSPAGQGGQPSAELSAAITRDFGSMDELKAKFVDGGVKTF
GSGWIWLCMDAAGKLSLVSTSNAAVPFTNNGPTPLLVADVWEHAYYVDYRNLRAKYLETF
WAQVNWNFVSENFASKKVRDLTKSMT

BLAST