GenomeNet

>bba:Bd3617 K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] | (GenBank) sodB; InterPro: Manganese and iron superoxide dismutase (SODM); hypothetical protein (EC:1.15.1.1) (A)
MFKLPNLPYAKTGIAPLFNEEQMTYHYDKHHKAYIDNLNKFMETDASLKGKSLEEITLTS
TGGIFNNAAQAWNHTFFWFGMSPAGQGGQPSAELSAAITRDFGSMDELKAKFVDGGVKTF
GSGWIWLCMDAAGKLSLVSTSNAAVPFTNNGPTPLLVADVWEHAYYVDYRNLRAKYLETF
WAQVNWNFVSENFASKKVRDLTKSMT

BLAST