GenomeNet

>bba:Bd3647 no KO assigned | (GenBank) predicted membrane protein (EC:3.2.1.18) (A)
MRFTKLAVTLFLATVTSLTAKGFVMTDAPYSPEHDDPQPPGWSAWSSLGGVGTSDPATCS
RSNFRTSLFVRGTDNALWYRQWNGTSWGSWTSLGGFLTSSPAAACWGPNRIDVFVRGGDN
ALWQRTFRNGSWQPWVSLGGFLTSGPAAATWSGGRLDVFVRGGDNALWHKWFTGGAWSGW
ESLGGVLTSDPAAVSWASGRLDVFVRGTDNALWHIWYWGGWSGWESLGGVLTSSPGVSSW
GNGRLDVYVRGTDNALWHKWYSGGWSAWESLGGVLSSGPDATSSARNRTLVFVKGTDNAI
WYRSWKQ

BLAST