GenomeNet

>bba:Bd3647 hypothetical protein (A)
MRFTKLAVTLFLATVTSLTAKGFVMTDAPYSPEHDDPQPPGWSAWSSLGGVGTSDPATCS
RSNFRTSLFVRGTDNALWYRQWNGTSWGSWTSLGGFLTSSPAAACWGPNRIDVFVRGGDN
ALWQRTFRNGSWQPWVSLGGFLTSGPAAATWSGGRLDVFVRGGDNALWHKWFTGGAWSGW
ESLGGVLTSDPAAVSWASGRLDVFVRGTDNALWHIWYWGGWSGWESLGGVLTSSPGVSSW
GNGRLDVYVRGTDNALWHKWYSGGWSAWESLGGVLSSGPDATSSARNRTLVFVKGTDNAI
WYRSWKQ

BLAST