GenomeNet

>bbat:Bdt_0579 ppc; hypothetical protein; K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] (A)
MAMQKQLAKELTSLVNWAVTELGHVIEAELGTRAFQRIENIRLHVKSKATRDINGLLKLK
TDMENLSNQERFEIAHSFALMLELINACESAYRTHRLREESSLVVSEEKHSYGRVIHVLT
AHPTESRNSDMLVYLRMIHELLLQRLQSSHSTQTARLHSLIRMAWHLPMSKQRKPTVMDE
AEYIYSLVLQDNVIDIYLQQRQEKNPFYIRTWVGGDKDGHPGVDEKTMLGSLNMSRQRLH
QWVARQFSEYMTELAPLVRSGLDQRKPTQKLQQHARAVKANLIKIRRISAGDAARVDRLT
KSLQNLSHEQGRIFGTESEKLNRIRFLLKIFPGLVVPLELREDSTLVHEALANPSKRPNI
TRMLMALSRLCPDHNPRDYVRGFVLSQCESAKDITAGVRLSSLHLKGPRLPVVPLFESSH
SLKSSKQIISEFLGTQKHVQLIKKHWSGQLEVMLGYSDSAKENGSFPSRYMIQSAIGTLE
KAIEGRGLTPIFFHGSGGSIERGGGSIQEQTEWWPLSALKTVKMTVQGEMIYRNYNSPDI
LQRQLNLLVENRDVRKQKPASRGSVATEKALSTLAGAIQSSYQNILKQEDFLELIEKATP
YSFMKDLRMGSRPSKRQGPVQLKSLRAIPWVLCWTQTRALFPTWWGLGSFWTGLSAADKN
KYRRAFKESSMFRTYIKAVGFTLEKIELDVFFMYLRSSKLSQSTVVKYEKSFRMEYAKAV
KCIREITGEKSLLWYRPWLETSIGLRSPLIHPLNVLQLVALETKDIKLLRETVTGVASGM
LTTG

BLAST