GenomeNet

>bbe:BBR47_29440 hypothetical protein; K10747 DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7] (A)
MSVRGRAITDTPTMSKIAYIDGRGEDLWDAIVARNMEGIVAKRKDGRYHADKRTDDFTKI
INYTYVDVQIAGYRKGDFGWLAYYNGRPAGVIEHGVPRTHKKAFYGVAKQLITGEDREYV
YLQPQIKARVKMRNWTKSGMLRSPVFVDFILAG

BLAST