GenomeNet

>bbe:BBR47_37860 hypothetical protein; K16149 1,4-alpha-glucan branching enzyme [EC:2.4.1.18] (A)
MHKGYLSLVLHAHLPYVRHGDRDDRLEERWVYEAMLECYLPLLMVFDKLLSDGIAFRMTL
AISPTLLSMLDDDLIVTRFRTHLAKTVELAGKEVKRTTGQPQENRIAKMYVERFRTIIAY
CRKWDFQLIKAFRHIADSGCLELITCAATHSFLPYVETEEAIRAQLLVGIDTHERILGRR
PKGIWLPECGYTPGLDRLLKEAGLRYFFVDSHTIEHATPLPRRGLLAPLFTPHDVAAFAR
DEVASRQVWSSIDGYPGDYDYREYYRDIGFDREMSYIEPYIHPEGIRVHTGLKYYRITGK
QGDKDWYEPSWAREKAASHAGHFLYHRERQVEEASQWMDRKPLVVATYDAELFGHWWFEG
PQFLDFLMRKTVCDSKEVKLMTPSEYLEEYPEQDRGHLPMSTWGRNGYGEVWLNENNGWI
YRHLHQAERELITAIITYSEKKGDQLALRCLKQAARELMLAQSSDWAFILDGQTVTRYAV
QRVHDHLVRMRALLAMYREHRLDEEAITQAEADFPIFPDVDITFYLPKQTHRVNVSRQLV
AAAQDQSSTKTVLMLAWEFPPHVVGGLGRAVYDLARHLAQQGIVVHVLTRATDSCAVEEM
MEGVHVHRLPTYIPSEQADFLAWVFQLNLAMVDAIYQLWSLGVRPDVIHAHDWLVSWAAI
ELKQRYSLPLVSTIHALEHGRHQGIHTPLQQRIHECERTLTQSSDAIIVCSKYMESEVKR
LFGTPSSHLRVIHNGVDLIPLTEVNREQLRQELAIGDGPVLFFVGRLVQEKGVHLLLEAM
ARLRAEFPHARLLIAGRGPMQDEWKLLVHQMGLSEQVRFLGFVDDGRRDELFALADVAVF
PSLYEPFGIVALEAMALGTPVLVADTGGLREIVRHGENGAMMYTGDPESLTNQLRWLLRD
PDQRHQLAQTAMQDVKQFYNWTLLASQTIDLYRSLSVPAEIGMTT

BLAST