GenomeNet

>bbh:BN112_2412 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (RefSeq) ribulose bisphosphate carboxylaseoxygenase,large subunit (A)
MSDRFEATYLIETPHDVASVAQELAGEQSTATSSRMPGETDALIRDFGARVEHIEALPPA
EAPSLPVAHTPGQRVHRARLTLSWPLHNIGDSLPMLLTTLLGNQTGMRRLSGIRLERVAM
PQSFIAAQPRPAFGIAGTRRLTGVQGRPLIGSIVKPNIGLAPEQTAAMARQLAEGGVDFI
KDDELLANPPYSPVARRAALVLRALDEAAQRTGRRTMYAVNITDGLDEMRRHHDAVVQAG
GTCIMVNLNSVGLSALLALRRHSQLPIHGHRAGWAMMTRCPALGMEFQPYQMLHRLAGVD
HLHVSGLGGKFWEHADSVLQAAHECLTPLDTQAGAADDRALPVFSGGSTIFDVAPTYQGI
GTADLIFASGGGIFGHPDGLAAGCASLRQAWEAAIAGQELRAYAQSRPELAAALARGKPV
RKA

BLAST