GenomeNet

>bbi:BBIF_1433 K01834 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11] | (GenBank) gpm5; phosphoglycerate mutase 1 family protein (A)
MTYKLVLLRHGQSAWNKTNQFTGWVDVPLTEQGEAEAKRGGELLKEKNVLPDIVFTSLLR
RAINTANIALDAADRLWIPVQRDWRLNERHYGALQGKNKTEIRQEYGDEKFMLWRRSYAT
PPPEIDPNDQYAQNHDPRYAGDPVPEAECLANVVERVKPYFESAIEPELRAGKTVLIAAH
GNSLRAIVKMLDNLSEDEIAKVNIPTAIPLLYELDENFKPVKPRGEYLDPEAAAAGAAAV
AAQGQK

BLAST