GenomeNet

>bbm:BN115_0985 ribulose bisphosphate carboxylaseoxygenase,large subunit; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MSDRFEATYLIETPHDVASVAQELAGEQSTATSSRMPGETDALIRDFGARVEHIEALPPA
EAPSLPVAHTPGQRVHRARLTLSWPLHNIGDSLPMLLTTLLGNQTGMRRLSGIRLERVAM
PQSFIAAQPRPAFGIAGTRRLTGVHGRPLIGSIVKPNIGLAPEQTAAMARQLAEGGVDFI
KDDELLANPPYSPVARRAALVLRALDEAAQRTGRRTMYAVNITDGLDEMRRHHDAVLQAG
GTCIMVNLNSVGLSALLALRRHSQLPIHGHRAGWAMMTRCPALGMEFQPYQMLHRLAGVD
HLHVSGLGGKFWEHADSVLQAAHECLTPLDTQAGAADDRALPVFSGGSTIFDVAPTYQGI
GTADLIFASGGGIFGHPDGLAAGCASLRQAWEAAIAGQELRAYAQSRPELAAALARGKPV
RKA

BLAST