GenomeNet

>bbo:BBOV_III007260 K00031 isocitrate dehydrogenase [EC:1.1.1.42] | (RefSeq) 17.m07637; isocitrate dehydrogenase, NADP-dependent family protein (A)
MQRPFLALSYLCSFVRRSGSTDQAFRRLSTSAGFRVDRDNSSTMAKIQVKNPIVELDGDE
MTRVMWSSVKEKLILPYVDIPLLYYDLSLPNRDATDDKVTFEAAEAIKQVGIGVKCATIT
PDEARLKEFGLKRMYRSPNGTIRNILDGTVFRSPILTKTVPAYIPGWKKPIIIGRHAFGD
QYNATDIKIPGAGTLELVFTPADGGPTQAYKVTDFKGPGVALSMFNVDQSIRGFARACFT
YALDVKMPLYMSTKNTILKSYDGRFKDIFQQMYDDEFRPLFEAAGIFYEHRLIDDMVAYA
CKSEGGFVWACKNYDGDVQSDIVSQAYGSLALMSSVLYSSDGKSFLAEAAHGTVTRHFRV
HQKGGSTSTNSIATIVAWARALEKRGLADGNDALVEFGRKLERAPVEAVDAGYYTKDLAI
AIHGPQATDYLDTESFMDKVKEFLEK

BLAST