GenomeNet

>bbo:BBOV_IV005280 23.m06368; succinate dehydrogenase iron-sulfur subunit (EC:1.3.5.1); K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] (A)
MSVCNYGLIRRCARRLSANGVTFSVFRYSPESGKRPRMQSYKVDTAACGPMILDALIKIK
NEQDSTLSFRRSCREGICGSCAMNVNGENCLACLRSIESCTNQGNSVEIQPLPGMYVLRD
LVADMTNFYEQYRTVQPWLKRKTPKSGEAEFLQSREDRALLDGMYECILCACCTTSCPSY
WWNPEHYIGPAALMQAYRWIEDSRDEYTVERMVDVNDSMKLYRCHGILNCTRACPKGLDP
AKAISKLKAKVEASADDTWRSIAASEYAKNNQTPLGGGDKQ

BLAST