GenomeNet

>bbr:BB1035 ribulose bisphosphate carboxylaseoxygenase,large subunit (EC:4.1.1.39); K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MSDRFEATYLIETPHDVASVAQELAGEQSTATSSRMPGETDALIRDFGARVEHIEALPPA
EAPSLPVAHTLGQRVHRARLTLSWPLHNIGDSLPMLLTTLLGNQTGMRRLSGIRLERVAM
PQSFIAAQPRPAFGIAGTRRLTGVQGRPLIGSIVKPNIGLAPEQTAAMARQLAEGGVDFI
KDDELLANPPYSPVARRAALVLRALDEAAQRTGRRTMYAVNITDGLDEMRRHHDAVVQAG
GTCIMVNLNSVGLSALLALRRHSQLPIHGHRAGWAMMTRCPALGMEFQPYQMLHRLAGVD
HLHVSGLGGKFWEHADSVLQAAHECLTPLDTQAGAADDRALPVFSGGSTIFDVAPTYQGI
GTADLIFASGGGIFGHPDGLAAGCASLRQAWEAAIAGQELRAYAQSRPELAAALARGKPV
RKA

BLAST