GenomeNet

>bbr:BB2845 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) Putative ATP-dependent DNA-ligase (A)
MTQPLRQYREKRDFRATAEPAGAARRPRAAARASEGLSFVIQRHQARRLHYDFRLEIDGV
LVSWAVPKGPSRDPSVKRLAVHVEDHPLEYGGFSGDIPKGQYGAGHVDIWDSGVWIPRGD
PRQGLRRGKLHFALRGRRLAGDWVLVRMSGEQDQWLLRKEDDEAAVPGDDAERAPATPPP
APEHAPAATPRGRRAAMPHTLAPQLATLVDSPPHGPGWSYEVKYDGYRILAACSAGGVRL
VSRGNEDWQARMAPLARALGALKLGRGWLDGEVVVLDERGVADFQLLQNALDGQAEGLVF
VAFDLPFWNGEDLRALPLQARQERLEDLLREVPEDAPLMLTQRLPVADDTEGKAAWNEAC
RLSLEGLICKRLDAPYRSGRSQGWLKLKCRPRQEFVIGGYTEPAGARRHLGALLVGLRQG
RQLRYAGRVGTGFGAATLRTLGQRLAALRQDAKPFSGDVPRGRGDAAIHWVSPELVAEVN
YAGITRDGLLRQASFAGLRADKPASEVRGEVAARPPAAKAATPSRRAGDGRAEVAGVRIS
HPDRLAYREPDYTKLQLAEYYAAIGPHILPHLRQRRVALLRCPDGAGTTCFFQKHLSQSL
PAGVRRDGGHLVIESLPGLIALVQYGAIEFHTWGADTRHPDTPDRITLDLDPGPGVAWPA
IVEGAQMARLLMQEVGLEPFLKTTGGKGLHLVAPLRPTQPWDTVKDFARALARQLAVALP
DRFTANMAKARRERRIFVDYLRNGNGATAVAAFSARARDGAPVSMPLSWDALDAGDDLRG
ARWNIANALEQARRKPDPWADYAASRRTLGSRMQARLPRD

BLAST