GenomeNet

>bbr:BB2845 Putative ATP-dependent DNA-ligase; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MTQPLRQYREKRDFRATAEPAGAARRPRAAARASEGLSFVIQRHQARRLHYDFRLEIDGV
LVSWAVPKGPSRDPSVKRLAVHVEDHPLEYGGFSGDIPKGQYGAGHVDIWDSGVWIPRGD
PRQGLRRGKLHFALRGRRLAGDWVLVRMSGEQDQWLLRKEDDEAAVPGDDAERAPATPPP
APEHAPAATPRGRRAAMPHTLAPQLATLVDSPPHGPGWSYEVKYDGYRILAACSAGGVRL
VSRGNEDWQARMAPLARALGALKLGRGWLDGEVVVLDERGVADFQLLQNALDGQAEGLVF
VAFDLPFWNGEDLRALPLQARQERLEDLLREVPEDAPLMLTQRLPVADDTEGKAAWNEAC
RLSLEGLICKRLDAPYRSGRSQGWLKLKCRPRQEFVIGGYTEPAGARRHLGALLVGLRQG
RQLRYAGRVGTGFGAATLRTLGQRLAALRQDAKPFSGDVPRGRGDAAIHWVSPELVAEVN
YAGITRDGLLRQASFAGLRADKPASEVRGEVAARPPAAKAATPSRRAGDGRAEVAGVRIS
HPDRLAYREPDYTKLQLAEYYAAIGPHILPHLRQRRVALLRCPDGAGTTCFFQKHLSQSL
PAGVRRDGGHLVIESLPGLIALVQYGAIEFHTWGADTRHPDTPDRITLDLDPGPGVAWPA
IVEGAQMARLLMQEVGLEPFLKTTGGKGLHLVAPLRPTQPWDTVKDFARALARQLAVALP
DRFTANMAKARRERRIFVDYLRNGNGATAVAAFSARARDGAPVSMPLSWDALDAGDDLRG
ARWNIANALEQARRKPDPWADYAASRRTLGSRMQARLPRD

BLAST