GenomeNet

>bbs:BbiDN127_0241 K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] | (GenBank) FAD dependent oxidoreductase family protein (A)
MEEYLNFMDNNKETKLKDLENQEFDLIIIGGGSTGLGIAVDAITRGYKTILIEKFDYAKG
TSSRSSKLIHGGVRYLAQWNISLVKEALHEKAILEKNAPHLINECALITPIYNVLEIPYY
YFGLIYYHNLMGKEKTAKYKTKLLSKTSTIEKAPNIKAEGLKCSVLYYDDSFDDARMAIT
LLRTFTEKGGIALNYTELKKFNKENGKLSGVLIQNKLSKEQISLKSKCIINATGIFSDEI
RRLDDEKALNIIKPSQGSHLIIKKDKFPKNHAILIPKTSDNRILFAIPWYDSVVCGSTDI
PIKEIEEEPKRFEEEIDFIINNLNSYLNIKIEKSDVKSVYTGIRPLIMDPKAKGNTSKIS
RNEKIFISDSNLITIAGGKYTTYRKMAEKTLLKAIEKNLIPNCAPTTEDLKLHGYLKKEE
AMKIPEPFRAYGSDFEILKNMRGFDKKIHENLDLNEAQIAFSIDFEQAKTIEDVLARRTR
SLPLNPQATIEAAPRVAEIMMKKLNKSEEWKNEQIKSFLEISKKYII

BLAST