GenomeNet

>bbv:HMPREF9228_0182 K01186 sialidase-1 [EC:3.2.1.18] | (GenBank) BNR/Asp-box repeat protein (A)
MSHIPNQIHQTWNSALLPEQGGTLHAAFHVATDGMLLEARNAERVALAVTVSRGSLVVEA
PEDHIVLDVEDTYGVQFGGVHDLHITFGDFGTRIYLDGYQAFACATNICPSKYAQAGVFH
CANEAHIGVERLECFSEAWTSERIQGSVPVPQPDIEFAAAYLADKDVKTLHGVTDGTIYA
QFRVRGVGQFGTILAARDDDRQIMNVDIDDDGFVYRAFVKGQWCEYRAHGDWNDGGWHDL
VIRAFRGAVDIYVDGNMETHQPGQVFFGDLEGLSYVSIGEDTAGVRLCGEVRGGGLFLYP
LGEGQIRKISDVPPTTDTALFDKGYEGSASYRIPSLVTTPSGVTIAGADQRVVISNDAPN
EIHFVVRRSLDSGQTWLPLQTVIAFPGDGLDGASVIDSCIVCDRETGRVTVVIDHFPGGR
GFANVEKGLGLDARGRLILHDGEGAEYLLQPDGAVTSLDGEATSYRVDEDGNVTRDGESA
GNIYLKEGVDPHESLLAARTSYLVEVHSDDDGETWSKPRHINHMVKEGWMGFLGTSPGNG
IQLSAGKHRGRLLIPYYCTGTSPKFNAGGALISDDGGQAWRRGKAINEGRVVNGKVVDER
DVRDDDATTHESVFVERANGDVLCLFRNQHHLGRVGKAVSHDGGDTWETVEFDPDLPDIF
SQPNAVTVPSKAGEEPGCASDRIVFANASLMRPYRGCGVLRLSEDGGRTWARNRCFNPYH
YVYQCMSVLPDGAIGLSWERETAGVYFTHLPLSWFGVKSAAEE

BLAST