GenomeNet

>bbv:HMPREF9228_0863 DNA-binding helix-turn-helix protein; K14260 alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2] (A)
MSVSAFAERLRNAMNSRELKQVDLVHAAERRGVKMGKSHISQYVAGKTMPREDVLLFLAD
ELDVDANWLRGRSSETKLNSDAQPASHIDTPSGAPTSAETEIPAARRRTFGKSHKLDDVL
YDVRGPVVDEAARMEQAGTHVLKLNIGNPAPFGFRTPDEVVYDMAQQLPETEGYSASKGL
FSARKAIMQYAQLKNIPNVTIEDIYTGNGVSELINLSMSALLDSGDEVLVPSPDYPLWTA
CVNLAGGTAVHYLCDEKSDWYPDIDDMRKKITDRTVAIVLINPNNPTGALYPKEVLQQIV
DLAREHQLMIFSDEIYDRLVMDGLEHISIASMAPDLFCVTFSGLSKSHMIAGYRVGWMIL
SGNKAIAKDYIEGINMLTNMRICSNVPAQSIVQTALGGHQSVHDYIVPGGRIHDQRDYIY
DALNSIPGITAVKPKAAFYIFPKIDIKKFNVHDDEQFALDLLHDKRILITRGGGFNWHEP
DHFRIVYLPRIEVLKDATNKLSDFLSYYWQS

BLAST