GenomeNet

>bbz:BbuZS7_0151 K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] | (GenBank) superoxide dismutase [Mn] (General stress protein 24) (A)
MFKLPELGYDYDAVEPYIDAKTMEIHHSKHHNGFVMNLNSILEKMGKIHLTDVSNILKNI
HDFPEEFQTLIRNNAGGYSNHTLYFRTLRPGNKDNLFEKFKDDINAAFGSLDVLKANLKD
TAMKIFGSGWAWLVLCPESGLKVISMPNQDSPLMNSYKPILGIDVWEHAYYLKYQNRRIE
YVDAFLKALNWEEVSKVYNEVIN

BLAST