GenomeNet

>bce:BC5330 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) thymidine kinase (A)
MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRYSEEDVVSHNG
LKVKAVPVSASKDIFEHITEELDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDF
RGLPFGQVPQLMAIAEHVTKLQAVCSVCGSPASRTQRLIDGEPAAFDDPIILVGASESYE
PRCRHCHAVPANKDK

BLAST