GenomeNet

>bcer:BCK_15420 K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] | (GenBank) tgl; transglutaminase (EC:2.3.2.13) (A)
MIVIGRSIVHPYITNEYEPFANEKQQILSIMAGNQEIYSFRTSGELSFDLNLRVHIITSA
LELFQSGFQFRTFQQSFCNPQYWKRTSLGGFELLPNIPPSIAIQDIFKNGKLYGTECATA
MIIIFYKALLALYEEETFNRLFANLLLYTWDYDQDLKLITKTGGDLVPGDLVYFKNPQVN
PATIEWQGENTIYLGNFFFYGHGVGVKTKEEIIYALNERRVPYAFISAFLTDTITRIDSR
LMSYHASPNTPQTSIGFIPIRDDAIVATVGNTTTVY

BLAST