GenomeNet

>bcg:BCG9842_B1453 K01834 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11] | (GenBank) putative phosphoglycerate mutase family protein (A)
MSTYIYMVRHGESPKLEGNERMRGLTEKGRMDARRVTDILKAEKIDTFISSPYNRAMLTI
EESANFHEKEIVVYENLKECMFSSEGQVISDKEVYPLVQKMFSNPDFSRTEGESYADCQR
RVVKVLKEILIDFQGRKIVIGTHGLVMTLMMNYFDKQYGFEFLMNTSKPDIYKMEFKEEQ
LMNVERLWKAE

BLAST