GenomeNet

>bch:Bcen2424_6483 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ATP-dependent DNA ligase LigD phosphoesterase module / ATP-dependent DNA ligase LigD polymerase module (A)
MAGKLDPYRRKRHFGATPEPEGAHGKRRAKPDTQAASKPKAKQPAARARHPLRFVIQEHH
ARRLHYDFRLELDGTLKSWAVPKGPSFDPQVKRLAVHVEDHPLEYASFEGEIPAGHYGAG
SVVVWDEGTWTPDGGVAQAREGYRAGKLTFRLDGEKLHGGWALVRSGRQEGRQEQWLLIK
ERDDDARSADEFDVVGERPGSVHDGAANGAARKRAARRGRSTDADGDVHDAQHASHESHE
SHESHASHRPTDPSQVEGAVRAPLPERVAPQLATLVDAPPTQGGWCYELKFDGYRILARI
AGKGARRRVTLMTREGRDWTAKLRAQRDALAALDVDDAWLDGEAVVLGENGLPDFQALQN
AFGTDRSDAITFFVFDLPYLDGYDLRDASLNDRRALLEPLLANSDPARVRFSPDLGEDVA
SLIASACDTGLEGLIGKRADSRYRAGRSPAWIKLKCRRRQEFVIGGFTEPSGSRHGFGAL
LLGVHEPAPAGKRRRGPGPLRYVGRVGTGFDARMLDRLAAILRKHERDTMPFDEPPRERT
RTRVHWVEPTLVAECEFAEWTGDGIVRQAAFIALREDKPAAQIVREMPKHTETEVTMDQR
PTPHDDTRKRASHAARESADRKQSARSRAAARAEDDASGPDTLGRVRITHPERVLDPQSG
TRKIDLARYWQWVAPWLLPDLEGRPVSLVRAPGDIAGELFFQKHAERREIPFVTQHEGLD
PGHGPLLSIDNVDALLGAAQMGTVELHTWNAHASNIERPDRIVFDLDPDPALPWRTMIDA
AQLVRGLLDELGLVSFCKTSGGKGLHVVVPLTRHAGWDDVKDFSRAVAQHVAGTLPDRFT
ATMGPRHRRGKIFVDYLRNGRGASTIAAYSVRARPGMGVSVPLDWDEVPDTTGGAQWTID
TLHERLDTLKRDPWEGYAKARQRITAAMRARLGADT

BLAST