GenomeNet

>bck:BCO26_1265 ligD; DNA ligase D; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MKPMLPVLKWSLPDTGKWVYEIKYDGYRAILDWTEDGMRLWSRNGKDLLPRFPEIRTFLQ
TLEGRVKGQLPLRLDGELVLLENPYKAGFRELQRRGRMKAEAAAEQAKMRPAHYLVFDLL
MLGGEDMAGKPYLQRKKALENLCETLALPLSPAPGETARVQQIPFTRDASVLKETVKNFN
SEGIVAKQTDSKWEAGKRVETWIKVKNWKTAACFITAYDEKNGYFDVAVFKDGGIFPIGQ
FLFSMNPDEKQILAEAVRKNAANNENGVYTIDPSICVEVFYLEWDGANLREPHFHRFRFD
LSPDACTFEDFRLRNAAIPEEVEVTHPDKPLWKKRHVAKLDFLAYMREISPFMLPFLSDR
LLTVIRYPHGVFGEAFYQKNCPDYAPAFVDTAMHEDIRYIVCNHLKTLMWLANQLAVEYH
IPFQTVNSRFVSEIVFDFDPPSRDAFQLAVEAALLLKQVTDALHLESFVKISGNKGLQVY
IPLPDGQFSWEDTRLFTEFVAAYFISKSPEHFTIERMKKKRGGKLYVDFVQHAEGKTIIA
PYSMRGHEDALVAAPLFWEEVNASLSPYDFTIETVLSRVNRYGCPFARFFACKSGQPFAP
VLAFLKQNKGRPI

BLAST