GenomeNet

>bcl:ABC1601 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) conserved hypothetical protein (A)
MKPMKLTETTAFPQSTGWVAEPKYDGYRCLVSITDTSIELISRNGRLLNHAFPEVVSAFE
ERRTKLSNELPLVLDGELVCLLNGYASHFPAVQTRSRMSNVHVIEKEMVSRPCQWIAFDI
LNQPNVPYRERRKQLLSFCKRADIPALTPLGGVPTLGVVESTSAIQALLTTVKRYNGEGI
VLKKQLSPYNQNIRSKDWLKLKHYRLVPVLVTFFDATNGYFHGSVYHQQGALNEVAIFKH
GLLPDDAKTLANFFRTKGTAEKNGFRLAPSIVVELACIGLSGGQLREVSFVRFLHHADPN
DITMTTLFHGLYPLPDIVETTSLDKPLWEQVTKADYLHYLQAVMPFMLPFLYQRALTVIR
FPHGTFANERFYQKHIPNYAPAYVNSAWLEDICYILCNNPETLIWLGNQLALELHIPFQT
IESSKPDEIVFDLDPPSQDQFGLAQEAALDMKQIFNRFQLPFFCKTTGGKGLQVHIPLEK
QTLTYEETGRFMKFVADFLCQQKPGKYTTERLKKKRRNRLYIDYVQHAYNKTVIAPYSMR
ETGFAAVPLREDELASPTLSPQQFSYVDVLRRIQQFENPFIGYERERVSKERFIQLLDEI
GI

BLAST