GenomeNet

>bco:Bcell_0182 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ATP dependent DNA ligase (A)
MLFTPVKPMLLTMGKEPTNHPEHLYDIKWDGWRILIHKQGNRIEAYTRHGNQVTNQFPEL
QEALSHINKHTAILDCEGVVLRNGNSVFEDFAYRGRLKSTEKIRKAMITHPVTFVAFDIL
ATDKPLLKETLIKRKQYLKDIITPSNVLLATPYVIEDGQTLHTLTKEKGMEGIVEKPLNS
LYHLDTRSPNWLKHKHFKRLDTVIMGYKENPFTMIVGSTFSNGKLKPVAQVEFGFNPEDK
QAFRGIANRLITKEENGVFWLEPLLCCSTQYLEKTSKNMLRITSFKGFLPEKKVEECVFT

BLAST