GenomeNet

>bct:GEM_0997 superoxide dismutase, copper/zinc binding protein (EC:1.15.1.1); K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] (A)
MNQRHHGVRAGRARRALLAAAALGLLAGCTSFSSSHEKRADAQLQPTVGSQARGAVTFVE
RPDGVQVTYNLVGLPPNSDHALQVHERGDCNAGDGSSTGQVFAPAADRLRAGARVAGDLG
NIHADANGVAAGFIVAPDLALDGVRSALNRAVLVYREPSDPAFPQHGAGPALACGVIR

BLAST