GenomeNet

>bct:GEM_5031 glutathione S-transferase-like protein (EC:5.2.1.2); K04097 glutathione S-transferase [EC:2.5.1.18] (A)
MESTGPTTLTISSRNYSSWSMRGWLLAKLSGLAFETVSVPIDAASRAELLLLSPSILVPC
LTHEGSTVWDTLAIAEYLNEVQPQARLLPDDRHARAHCRSICGEMHSGFSALRSALPMNL
RAHFPGFRIWSRAQHDIERIVTIWRECLAAYGGPWLFGEQIGIADAMYAPVVTRFLTYDV
KLEPDIAEYCMRMLAHPFVAEWIDAAKAEHEDIDELDMEF

BLAST