GenomeNet

>bct:GEM_5031 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) glutathione S-transferase-like protein (EC:5.2.1.2) (A)
MESTGPTTLTISSRNYSSWSMRGWLLAKLSGLAFETVSVPIDAASRAELLLLSPSILVPC
LTHEGSTVWDTLAIAEYLNEVQPQARLLPDDRHARAHCRSICGEMHSGFSALRSALPMNL
RAHFPGFRIWSRAQHDIERIVTIWRECLAAYGGPWLFGEQIGIADAMYAPVVTRFLTYDV
KLEPDIAEYCMRMLAHPFVAEWIDAAKAEHEDIDELDMEF

BLAST