GenomeNet

>bcu:BCAH820_3758 K01834 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11] | (GenBank) putative phosphoglycerate mutase family protein (A)
MNTYIYMVRHGESPKLDGGERTRGLTEKGSLDVHKVTDILKTEGIDTFISSPYKRAVLTI
EKTANLYEKEILIYENLKECMFSSGDQVISDKEVYPLVKKMFSNPDFALAEGESYADCQR
RVVKVLKEILMDFQGQKIVIGTHGLVMTLMMNYFDKQYGFEFLMNTSKPDIYKMEFKEKQ
LMNVERLWKAE

BLAST