GenomeNet

>bcv:Bcav_0491 DNA primase small subunit; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MARAQTPPVELDVAGRTVKVSSPDKVLFAGVGDGVTKLDVVRYFISVGEGILAALKERPT
TLERWPQGYADGMKLTTRQGAKGDGFYSKRVPQYAPDWVEPVEITFPSGRTAEEVCPSEL
AVVAWAAQQGTLTFHPWPVRRPEVDSPDQLRIDLDPQPGTDYVDSARLAPLVREVAAEAG
LTAVPKTSGGRGVHVFAPIEPRWSFVEARRAVIALGREVERRAPEQVTTNWWKEERGERV
FIDFNQMARDRTIASAYSIRANVRATVSAPLRWDEVDQVQPDDFTVLTMPDRFAEVGDLF
AGANGDADHPAGSLDVLLEWAARDERDHGLGDLPYPPEYPKMPGEPKRVQPSRDRDRPRD
D

BLAST