GenomeNet

>bcv:Bcav_0491 DNA primase small subunit (A)
MARAQTPPVELDVAGRTVKVSSPDKVLFAGVGDGVTKLDVVRYFISVGEGILAALKERPT
TLERWPQGYADGMKLTTRQGAKGDGFYSKRVPQYAPDWVEPVEITFPSGRTAEEVCPSEL
AVVAWAAQQGTLTFHPWPVRRPEVDSPDQLRIDLDPQPGTDYVDSARLAPLVREVAAEAG
LTAVPKTSGGRGVHVFAPIEPRWSFVEARRAVIALGREVERRAPEQVTTNWWKEERGERV
FIDFNQMARDRTIASAYSIRANVRATVSAPLRWDEVDQVQPDDFTVLTMPDRFAEVGDLF
AGANGDADHPAGSLDVLLEWAARDERDHGLGDLPYPPEYPKMPGEPKRVQPSRDRDRPRD
D

BLAST