GenomeNet

>bcv:Bcav_0664 DNA polymerase LigD, polymerase domain-containing protein (A)
MAREASDAVELEIADKVVRLTHPDRVYFPEHGYTKRDLAEYYVAVGDGIVRALRERPCML
HRFPKGIAEKKVHQKRVPAGAPPWVRTVRVEFPRYGRHAYELCVTEPAQVIWAVQMSTVE
FHPWNSRAADTEKPDEWRIDLDPGPDCPFSRVQRVAGVVHEVLDELGAVGWPKTSGGSGL
HIYVRIEPRYGFKDVRRAALAFAREIERRAPDDVTTTWWTRDRDPALLFVDYNQNARDHT
IAAAYSVRGVPDARVSAPITWAEVPDVDPHDFTIGTMPDRFEALGDLHAGIDDAVFSIEP
LLEWAERDERAGADAGGPTDEADDADESDQEEHA

BLAST