GenomeNet

>bcv:Bcav_0664 no KO assigned | (GenBank) DNA polymerase LigD, polymerase domain protein (A)
MAREASDAVELEIADKVVRLTHPDRVYFPEHGYTKRDLAEYYVAVGDGIVRALRERPCML
HRFPKGIAEKKVHQKRVPAGAPPWVRTVRVEFPRYGRHAYELCVTEPAQVIWAVQMSTVE
FHPWNSRAADTEKPDEWRIDLDPGPDCPFSRVQRVAGVVHEVLDELGAVGWPKTSGGSGL
HIYVRIEPRYGFKDVRRAALAFAREIERRAPDDVTTTWWTRDRDPALLFVDYNQNARDHT
IAAAYSVRGVPDARVSAPITWAEVPDVDPHDFTIGTMPDRFEALGDLHAGIDDAVFSIEP
LLEWAERDERAGADAGGPTDEADDADESDQEEHA

BLAST