GenomeNet

>bdi:100830020 dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial-like; K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] (A)
MSAAHLLRHSRKLRSLRNVVDCERAGLARFFSTGSCSFAVKENGVEKRIGGSTFSQCDQP
GKDLQTFKVSLGGVIRSSTCRRTPSSRISSAVTGINGSLSRVQVLSSRSFSSSADLPPHQ
EIGMPSLSPTMTEGNIAKWVKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIVQGD
GAKEIKVGEIICVTVEEEGDIEKFKDYKPSTSSDAPVAPAESKPKSEPAEPKVEEKEPAK
APEPKALKTAEPQRSGDRIFSSPLARKLAEDTNVPLSSVKGTGPDGRILKADIEDYLASV
AKGGKSESFAASGLDYTDIPNAQIRKVTANRLLTSKQTIPHYYLTVDTCVDKLIKLRGEL
NPLQDASGGKKISINDLVIKAAALALRKVPQCNSSWMNDFIRQYNNVNINVAVQTEHGLF
VPVIKDADKKGLGTIAEEVKQLAQRARDNSLKPADYEGGTFTVSNLGGPFGIKQFCAIIN
PPQSAILAIGSAEKRVIPGGADGQYEFGSFMSVTMSCDHRVIDGAIGAEFLKAFKGYVEN
PTTMLL

BLAST