GenomeNet

>bdi:100835132 cytochrome b-c1 complex subunit Rieske, mitochondrial-like; K00411 ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2] (A)
MLRVAGRRISSHLAWRPAAAASAGRSPLAGGLPGDDSRDQKPRFAIDSPFYAAARGFSAE
TLVPRNQDVGLAELPATTAALKNPSAKIVYDEYNHERYPPGDPSKRAFAYFVLSGGRFVY
ASLLRLLVLKFVLSMSASKDVLALASLEVDLSSIEPGTTVTVKWRGKPVFIRRRTEADVK
LANSVDVASLRDPQEDAVRVKNPEWLVVIGVCTHLGCIPLPNSGDFGGWFCPCHGSHYDI
SGRIRKGPAPYNLEVPTYSFLEENKMLIG

BLAST