GenomeNet

>bdi:100839523 dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial; K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] (A)
MLLRVRSRLPAAALSRAAIHPRASPAPGPVPPQHRPVGTANQGSQLEPRSGWIGRARGHA
TMARANPVTLLPASLAGHYKVGTQVRRFSSTGLPPHMVIGMPALSPTMNQGNLAKWRKQE
GDKIEVGDVICEIETDKATLEFESLEEGYLAKILVPEGSKDVQVGEPIFVTVEESEDIKN
IPADTSFGGEQKEEQSSGSAAQSVQVDAAETSSVTSRISPAAKMLIKEHGLDASLLKASG
PRGTLLKGDVLAALKSGTASSAKEQTAPVAPSPKPTRDTQAQSPITSQKSDTFEDITNTQ
IRKVIAKRLLESKQTTPHLYLSKDVILDPLLAFRNELKEQHGVKVSVNDIVIKAVALALR
NVPEANAYWDTAKQEAQKCDSVDISIAVATEKGLMTPIIRNADQKTISAISSEVKQLAKK
ARAGKLAPNEFQGGSFSISNLGMYPVDHFCAIINPPQAGILAVGRGNKVVEPVMDSDGTE
KAAVLTKMSLTLSADHRIFDGQVGGKFFTELASNFSDIRRLLL

BLAST