GenomeNet

>bex:A11Q_1230 hypothetical protein; K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] (A)
MTHLSSELRTLVYQSVFQFGLVIQRELGEKKYNMVESIRKKMVELRKASDENSFQQLNTL
YRQIEKWSTEDRTHLAHAFTLMLELMNACENAYRSYRLDQKDHTSVAPKSKLPSAVIYVL
TAHPTEARSPQNIAVFHLIQDLLQQSLVRATNIKAEFSLTASESEKLFHLLELAWHTPIA
RKRSPHVKDEAEHIYSLILRDHVLLALLDMESHDVPLFIRTWVGGDKDGHPGVNEKVMRE
SLSLSRKRLVEVATDLLRQVQQSLDYTQSSKLLTDLQTDLQKVKKALSQIKVLKKSDAKR
IDSMHKLVHSFLGLYTRSFGVEHPSLLQLKKLLHIFPALVIPLELRESSDVLMSRPLSQP
SLVIDRMLRLLADLSDGGDPRWYVRGFIISMTQKPEHVIMAFKRQRLFLKKRSIPVIPLF
EDAESLRDAEQIMQVLLKMPQIKSAAKNDWGARFEMMVGYSDSSKESGALYSRIAIATAL
PQLERVCKKAGLTSVFFHGSGGSVDRGGGSIDDQIAWWPKTALDRYKVTIQGEMIDRSLA
TPSIAQRQVQKIIEYAAKGLTQKSQPLPSSELKKFSGRVASYYRQTITESEFLKISERAT
PYSYLNLLKIGSRPSKRSGELTVKNLRAIPWVLCWTQTRVLFQTWWGVGSAWEESTSAQK
KALKASYKKEAVFRSYIKALGFTIAKVEMPVWKVYLSQCGLPQSEVDMVYASFQKEYQRT
IRAYQEITGEKQFLWFRPWLGESIQLRSSMIHPLNLLQITAKKKNEADLLRVTVTGISSG
MLTTG

BLAST