GenomeNet

>bfg:BF638R_0630 tdk; putative thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MVLFSEDHIQETRRRGRIEVICGSMFSGKTEELIRRMKRAKFARQRVEIFKPAIDTRYSE
GDVVSHDSNSISSTPIDSSASILLFTSEIDVVGIDEAQFFDSGLIDVCNQLANNGVRVII
AGLDMDFKGVPFGPMPALCAIADEVSKVHAICVKCGQLASFSHRTVKNDKQVLLGETAQY
EPLCRECYQRALQEDREKS

BLAST