GenomeNet

>bfo:BRAFLDRAFT_103129 K11406 histone deacetylase 4/5 [EC:3.5.1.98] | (RefSeq) hypothetical protein (A)
MVIDGREQQGSAGGEVEDRLNYIKQQQALQRELLHQHFRQQEEQLARQHQAELQQHLHLQ
KLQALREQQELAQARGKLQEKQSERQKQLLAGKKKENSAMASTEVKEKLQTFILSKKQRE
AAANSLHQSPSLSMAHWPHGSLGHMPMSGDLAAAAAYKGHPMLGTYGSNADFPLRKTASE
PNLKVRSRLKQKVAERRSSPLLRRRDGIGGSFKTRKPLSNKIHIQVPQSAPGSGPSSPRS
SHSNMVIAGNHEESGVQPAVVPGRMVGGNAADFTLYTSPSLPNISLGLANSSSSAETTQT
GEKVVQSALSREAELRAMAAARLGQPLTVVPAREPQPAPRSDEGLGTAGHSPSNCAASAS
RPLGRTHSAPLPGTHMHHLQQQVLHPQHYMQALLRQHVVNKQQLGNGDIAKQPRPEPHPE
ETEEELKEHTQVTVKQEPLDSDEENEEEESCRQLDMNIDGTSTHRPLSRAQSSPATYNSV
KSVFTTGVVYDPLMLKHSCSCGNNSYHPEHSGRIQSVWSRLQETGLVNRCERVRSRKATI
DELKTCHSEQHVYLYGTNPLHRQKQDSKKLAGGLQKSFKYLPCGGLGVDADTIWNELHSP
SALRMAAGCVIELAFKVAQGELKNGFAVVRPPGHHAEVDQAMGFCFFNSIAVTARLLVQR
LKLNKVLIVDWDVHHGNGTQQMFYEDGQVLYVSLHRWDSGNFFPGTGAPDECGNGAGLGK
NVNISFSGGLEPPMGDAEYMAAFRTVVMPIAVEFSPDLVLVSAGFDTAEGHAPQLGGYKV
TPKCFGHMTKQLMSVAGGRVVLALEGGYDLAAICDCSEMCVQALLGDELPPLPKEIIEQP
PNKNAVTSLEETIRRQTPHWSSLSRYASTVGYSLYEAYEREKEEADTVSALASLSVASAP
GVGMPASANSERNHKPQPLEDTINGL

BLAST