GenomeNet

>bfo:BRAFLDRAFT_105101 K01229 lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62] | (RefSeq) SUFU; hypothetical protein (A)
MLSLLTTSLLLGFTCGAVYDYGAYNRTRDNFRPGTFPDDFIWSTATASYQIEGAWNVDGK
GESIWDRFSHTPGKVDRGDTGDVACDSYNKYREDVQLMKAMGLKYYRFSLSWPRIFPDGT
VAGGVNQAGVDYYNNVIDELLANGITPMVTLYHWDLPQALQDRYGGWVNEELVRHFNDYA
DFVFQTFGDRVTYWITFNEPWVVCFLGYGTGGNAPGIQDSGNSTYLCGHTILKAHAEAWH
TYDTTYRRSQQGQISITLNCDWPEPRDPDSPADVAAADRYIQFYIGWFAHPIYSAAGDYP
AAMKDIIREKSLAEGLQESRLPQFTPAEIDRIKGTGDFFGLNHYTARIIQNRVDPTDTPG
YSNDRNLSESTAPEWPRAASEWLYVVPWGLRRLLKFIKLNYGDPDVFITENGRSDHDEQP
PVMEDADRICYYMGYIDEVLKAIEVDGVKVRAYTAWSLMDNFEWSRGYTERFGLHYVNFT
DPRRPRVPKESAGFYSDIIANNGFPEGADVTTMVRSRLLQSYLGTAGLTRVLVKMSGTML
GLFATSLLLGLVWGAEYNYGAYDHSRDAFRPGRFPDGFIWSTATASYQIEGGWEADGKGE
SIWDRFSHTPGKVDRGDTGDVACDSYNKYREDVQLMTDLGLKYYRFSLSWTRIFPDGTLA
SGPNEAGVAYYNNLIDELVRNGVTPMVTLYHWDLPQNLQDTYGGWVSQGIVKHFNDYATF
AFQTFGDRVRYWITFNEPWVVCYIGYGTGEHAPGIQDERNSTYLCGHNILKAHANAWHTY
DTGFRQSQGGQVGITLNSDWAEPRDPDLDADVIATDRYLQFYLGWFANPIYSVGGDYPVV
MKEAVLAKSQAEGLRESRLPQFTQEEVEYIRGTSDFFGLNHYTTRIIADNVVVGAAPGYA
NDRDIAQYTAPEWSRAESEWLYEVPWGLRRLLNFIKLNYGDPEVLVTENGRSDGDVTPPL
MVDTCRICYYMTYIDEVLKAIDLDGVKVRAYTAWSLMDNFEWARGYTERFGLHYVDFNDL
NRPRTPKESAGFFKDVIANNGFPEGADVTRMVQDMWRDCRGAGAKSHADIALLALAFIIT
AMYNLVYM

BLAST