GenomeNet

>bfo:BRAFLDRAFT_105744 K01359 proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93] | (RefSeq) hypothetical protein (A)
MGRFSTWLVLAIVAFFSHGRAEGGEDQPDHFTNTWAVEIYGGPEKADLLAREHGYENLGQ
IGNLEDHYLFRHKDVPHRSRRGAHQHTKRLGDDERHDTRTSTNLPKLDLHVLPVWRKGIT
GKGIVVAVLDDGIEKDHPDLVDNYDPDASFDFNDNDADPQPRYEETNENKHGTRCAGEIA
MAANNSECGVGIAFNARIGGVRMLDGVVTDAVEANSIGFNIQHVDIYSASWGPNDDGKTV
EGPEKLARAAFEKGVREGRRGKGSIFAWASGNGGSNGDNCDCDGYTSSIYTVSISSASQQ
GRSPWYGEKCASTLATAYSSGEYKDQKISSTDLHHECTDSHTGTSAAAPLAAGVLALALE
ANPDLTWRDVQHLIVWTSEYDPLSGNPGWFQNGAGLWVNSRFGFGLLNAEAMVDMAQTWK
TVPEKNTCEVRIENFQPRNLGNGEEITIEMETDGCRGNNHVEALEHVQVKTTIDYTRRGD
LRIVLTSPSGTSTTLLDTRRQDKSQMGFQDWPFMSTHNWGEKPQGKWTLTIEDKSDHAEN
NGVVKDVVLILHGTPEQPAYQSGGRVYTDYNRVQDDRNVEISAAKSAPAPAADAAPARES
EDWIPSSGPFGSAGSVVIAETPEKETDFLVNWQDGMNRYEPDFNPVNSVPFEPAADAGSD
VYMDAEDLRPWEAFKYLHRQMKSPSSPRHPAHAYNKPSSQYIRDPWVSQNALDNEANLVK
YYLQLLGYEP

BLAST