GenomeNet

>bfo:BRAFLDRAFT_119901 K10776 DNA ligase 3 [EC:6.5.1.1] | (RefSeq) hypothetical protein (A)
MHRENKGLRTSRFCVEYAKQGRAGCKKCKQKIEKGLPRIGKIVPNFFHEGDGEMKQWYHV
ACIFETFQRARATTKKIEDASDLEGWEDMEDEEKQTILKLIKELESKAKSPKKKVVQATL
STKGKIQSPTKKAASSATVSDDSPAAGPSSSSSASTSVSMTSPTPTPDIDHKDNAFREFR
RLCALIAEEPGYNAKTKLVSDFLKKGSNGDGFKGDTFLVVKLLLPGVVKRVYNLNNKQLL
KHFANIFGVNLADMLTDLELGDVSETVRKFFEESERCLPAKKSKLTIQEVDESLEILAQM
TKEDDQMRELNKIAKKCTANDLKVVVRLIKHDLRINAGAKHILEGLDPNAYPAFQASRNL
ADVVERVVANGCAPGMKKSLSIKANLMTPVLPMLAEACKSVEMAMRKCPNGMYAEIKYDG
ERVQVHKQGNKFEYFSRSLKPVLPHKVAHFKDYIPKAFPHGSNMILDSEVLLVDTNTGNP
LPFGTLGIHKKQQFSDAQVALFVFDCIYFNGETLMDRPISERRKFLEDNMTVIPNRVVLS
EYRYITEPGDLSDMIGRVIRDGLEGLVLKDTKSIYEPGKRHWLKVKKDYLEQGAMADTAD
LVVLGAFYGTGNKGGLKSVFLMGVYDPDSDKWCTVTKCGNGHDDNTIAKLNKELAMVKIS
KDMSKVPKWLKITKNLVPDFVCADPKKAPVWEITGAEFSKSEAHTADGISIRFPRVTKIR
DDKDWKSATNLKQLKHLFKTSKETSDIPDLLKGKGKSPRKPVKVKVEEEDDDDDDDDDSN
GGASSNGVTPIKGMKRKAEEDSPRTPKKSKPTCRYGATCYQTGKEHLDKFDHPTRKSPKK
SNSAAKSVLPDVFCGIKLFLPDTVENYALLRRYFVAYDGDIVQDYAMSQATHVVEDPEQK
NMNGKTDAQLVTVDWLWQCIKRKQLVPV

BLAST