GenomeNet

>bfo:BRAFLDRAFT_121298 hypothetical protein; K01360 proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94] (A)
MVKPAGWFLRRVQYLLVLATILVWYGACNSAPPYTNDFAVQIRDGKPDTAELLARKYGYL
NLGQIREQRDLYHFRHRGVPHVRRRRSAAQQSRLENDMRVRAAVQQQGFRRRKRGYNEVN
NDNYRQIDINDPLFPKQWYLLNTGQADGKAGLDLNVLEAWEMGYTGEGVTIAIMDDGVDY
LHPDLADNYNADASYDFSSNDAFPYPRYTDDWFNSHGTRCAGEVVGKINNGLCGVGVAYG
ARVAGIRMLDQPFMTDIIEASSMGHKPQEIDIYSASWGPTDDGRTVDGPRELTVQAMADG
VNKGRGGKGSIYVWASGDGGSQDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLA
STFSNGRNRHPEAGVATTDLYGNCTLKHSGTSAAAPEAAGVFALALEANPNLTWRDMQHL
TVLTSKRNQLYDPVHEWRRNGVGLEFNHLFGFGVLDAGSMVKMAQDWNTVPKRFHCTGTS
MSDAKPIPVEGKVVVKLTTDACEGQENFVRYLEHVQAVVTLRSTRRGDVNINMTSPMGTQ
SILLSSRPNDDDSVKGFDRWPFMTTHTWGEDPRGDWVLEVGFQGDEPQEGDLLEWTLRLH
GTQSAPYIDQVVDEWHTKLGMEKKRQELDLKEEKEEEKEEEEKRQEKEKAEAEEDETTKD
DEEDDEETAPKKGKEGGSSWLSLKPNYMIGL

BLAST