GenomeNet

>bfo:BRAFLDRAFT_125552 hypothetical protein; K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] (A)
MLRRAVRRKDETSGTKREGTEDAGEDTEGPKKVLRTFQDKKTWKAARKAKEESALEELVL
GRRQEEPTDRLQDAEHQSEDPSEEGSDDDVDSLGVVDTREAAWVDDDDDDDDRTRVEKTS
DVPSWAQTSQGRKRQHESDDDSDEELLQHTGDLLAESSALPRGNINIKRCSDVNKTYPHQ
GPVRRVEFHPSAQVDGRNNPKIQTLHLEKFPVRTAHFSTCGREVILASTFKWFFVYDMIA
GKVIKIPKIRGVDDTSLSRFEVSPDGRFLLFVLVCVCLRVSVLKVNMFVLMFMTGVDDTS
LSRFEVSPDGRFLLFLGKNGFLHLLSAKTKECVSSLKMNSDVSAGTFSKDSRHLYSVGDD
GEVYVWDVGTRDCIHKFVDEGCTHATTIALSHNSKYLATGSQSGVVNIYDTQRALTSSYP
TPLKALLNLTTPVTQTTFNHTGEVMAMCSNEVFKAARLVHLPTLSVFSNFPEADSTVKRV
QCLDFSPHSGYLAMGNNQGRAMLYRWDQTLQGLLIQPVPRPSCHQGLNGLPDRRGGHGDR
KGGHAGHHGHWRAYKLLVDPALQKGHQQKLDKVYRYDGVVQGKPDLYPPIHVRDPRRLSR
LWRRNEPADLPVPKFKVDDFYVGSPPRRQITFSNLNDNINSGFLQEMCKKFGTIEEMKIY
HHPKTRKHLGLAKVVFATTTAAKDASNKLHRTSVMGNIISVQIDSKGKIREQLYDSIVHN
KPSQEAPQVSKADPRRLSLDERPHAFMPPQRNLPIIPEAHHRPEAPLPPAPLPPARHDVV
PPVYPPVPPEVHPAGVPPGVPPGVPPGVPPGAAGVPPGVYQQPPRPDGHKGYYSDPRRRL
SSEGGAFAPYDNVSAHNSFPRPPAGMDDQGYYSNTPSSYSGQGYHGNSYHSNTPSLSEST
PSYVPTPSSFHSSGQTPQSYPGGVQPPNFAVHTPGSYYSGTPVGFHGNTPQYSGNTTAPV
TVVATTASTTVSVATPTQPPEDPAQNGGEKPADKGSLSLDSRIELLLKQQRTFPALGGMS
PSYSEEEKGERSPTPPPLESFTPPHDASPRPPPQNSTPSSLQLLKTDDLLEEISPGSLAD
SDEDKNKGKSAGKEEEAVTMVTDRNAEVPTPVMDEEKGEGDMDISSGNDSDDDDKMSLSP
LSSPEQSKLVVNPPPTPVYPPNVPPPNFPPPNIPPPMLPNPSVPPPNIPPPNIPPPGMEP
SAPSIPPPGLPPPPLPPVSSLPMPPSSVPPYSSNFTNPMLPNQQQQHLARMGLWRPGMHN
YGNHGNQQPKGPFPFPPPLSANQGPPRQPQMRGPRPFGQGATFRPWRPMFDPTVPPPGYV
PPVEKVDPHKQTIDGVMERIVWELKEIMRKDLNRKMVESSAFKAFETWWDREEEKTKVPI
KSEEKDEDKVVEPEVKVKPKPSKSLFEQPAALPSISNMDSFSPFGPSGLGGLGLGIRAAM
PRMPSFKMKRKPPDSPAAEDGHPRKRSRLASPSMDDGSASDSDADKEDMLSQDSDLSRHG
TPILQRAHSLDSEGSEVRVVPRPEEEQKSIIEDDDDEDGDEEEEDEDYDEDEDLAEADAS
DEEFPEEDELMVSDDEDEADDESEGSESGEDSDSYLSSSDEEETLADVTETEREFSEAED
SEQVPDSDATLPVSHQRSAELGQDQVGHRVMVSPGQEQAQSIQPPPTLAARKQGLATPEH
AYSKQATSPSILSPRLPSPRLPGVLSPPLIPGSDSRTLPVDGATVAHGEDIRSVLDPHLQ
LRHLHRVPAGPAGPEDRVGASPVRPALLLPERSAFGFMSEATGAMLPSSPFPMEDLPRTP
GGNIDLPRTPGRGMTLQLPTDPAAVPGFLAPTQAGATAIPSSPWRGIPPSPSTSLPVPSL
PPLLAQFADIVTHEAMQRDVVAKDDSSEPPAAPPDTQTTPPQLLASQGKFSIASLLSPQQ
PARTEPLPPARLHPGLPITSEEHLRMLQANCQLPRFQSPPRPVQPPVQHLLPNQDQLLSR
ANNQAANVLANELLSPSKQTVADLLAASRTLERDVDVEGSDSEKTETSSEPEVSVDEVQE
RTSRQRVCPYMLEHNYAAPLPEHNYAARQPPSPAKPSLTHKQSKTRTEELPVVAAPPVCL
PVNIKTEPPPVEDLPKDKENEAPIEVSIPSVDLVTTEKEEPKQHRKTAEKEKEQILREQI
TNKIKEEAVKPEPLRFDPRDNLMEMEVLYEFLKTGIDLEDVKYLQSSYDSLLQQDNSGVD
WLNDTHWVYHPHILSQYSNTVTLVHRRKDDPTLGDHKTGCARSEGFYKISFKEKTKYLHR
ARLASVVEKPEDDLMESQNKAKQATQSSREARSNQRRLLASFGASCGDISDLLRFNQLKF
RKKQLSFRKSRIHDWGLFALEPIAAEEMVIEYVGQCIRQTIADERERRYEEQGIGSSYLF
RVDHDMIIDATKNGNLARFINHCCNPNCYAKIITVEGYKKIVIYSRRDIAVNEEITYDYK
FPIEDEKIPCLCGAENCRGTLN

BLAST