GenomeNet

>bfo:BRAFLDRAFT_129952 hypothetical protein; K11987 prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1] (A)
MNGAIIAICLTLLPVLIAAENPCCSMPCQNMGVCMREGDSYSCDCTRTGYYGQNCDIPEF
WTSIKVALKPSKKTTHHLLTNYKWLWNIVNRIPFLSKFIMRAVYKIRSATVDSPPMYHTG
HDYTSWDTYADRSYYTRALPPVPPGCPTPMGTAGRKELPSPQYIAETFLARRRFIPDKRR
TNVLFNFMAQHFTHQFFKTDFKKGAGRTWGDHGVDLSHIYGETVERQHQLRSFTDGKLKF
QRVEGEVYPPSLADAPVHMIYPPYVPEGKRFAIGHEFFGLLPGLFVYSTVWLREHNRVCD
VMKELHPDWDDERLFQTARLILTGETINIIINEYVQHLSGYNFDLFWDPELLFSDQFQYQ
NRIFVEFNHLYHWHPLMPDQFHINGSTYGMKDYLFNTDLVFKHGFGTTVDAMSRQIAGQI
GPKNIGPVNLKVAVETIKHERNLRMQGLNQYRKRFGIPPYKTFLELTGGDAEMADQLEEA
YGDVDAVELYVGLMVEQPAPGSVTSETIIEMGGPFSVKGLLSNPLCSPQWWKPSTFGGEA
GFRMVKTATLKDLFCRNTAGPCGLVSFAVPEDVQPTGLPEEQDASSQGKGASQNDADLVP
VNGVLSSQDKHLHKEEKTSQDGSQDPETSSKVTANEKPVAKNEKLPKNGVAQKKEFQNGS
PKNGRASKNDVPKNEPAPKNGLPTAFPKNGAAPRTYVNRTSCKQCDRIEL

BLAST